Chinese coronavirus - Page 86 - FaunaClassifieds
FaunaClassifieds  
 Sponsors »  Breeders | Dealers |  Importers/Exporters | Caging | Feed | Supplies | Services | Events 
  Inside FaunaClassifieds » Product Reviews |  Classifieds!   | Photo Gallery   | Banner Advertising 
 
  YES! You can option out of the Google and InfoLinks ads! Click here!

Go Back   FaunaClassifieds > General Interest Forums > Preparedness & Self-Reliance Forum

Notices

Preparedness & Self-Reliance Forum Survivalism, Livestock, Preparedness, Self Reliant Homesteading, Individual Liberty

Reply
 
Thread Tools Display Modes
Old 07-23-2021, 01:48 AM   #851
WebSlave
Ivermectin saves India

Quote:
Ivermectin saves India

by Dr. Justus Hope, MD Jun 14, 2021 Updated Jun 14, 2021

India saw a dramatic fall in cases after the ICMR and AIIMS added Ivermectin to their protocols on April 20, 2021. Daily COVID-19 cases, which peaked at 414,188, are now down to 84,332, representing a drop of 80% overall in the country of India.

What seemed to be an impending humanitarian crisis at the end of April has now been brought under control, not with mass vaccination, but instead with an inexpensive repurposed drug, Ivermectin.

https://www.amazon.com/Ivermectin-Wo.../dp/B0943T564G

Those Indian states that adopted more aggressive Ivermectin policies saw their cases fall far more than 80%, states like Uttar Pradesh - down 98% [37,944 to 596], like Uttarakhand - down 97% [9642 to 287] and Goa - down 90% [4195 to 423]. Delhi saw a 99% drop [28,395 to 238].

Tamil Nadu, which publicly banned Ivermectin, saw their cases rise to the highest in India, and they continued setting state records until May 21, 2021, when they peaked at 36,184.

Meanwhile, deaths have also dropped markedly in Delhi, among the first areas to adopt Ivermectin. Their deaths have plummeted from 448 on May 3 to 36 on June 9, a drop of 92%.

By contrast, Tamil Nadu's deaths rose ten-fold from April 20 to May 27. On June 9, Tamil Nadu's COVID-19 deaths remained the second highest in India at 405, while the states that chose Ivermectin were all dramatically better.

On June 9, Tamil Nadu, with a population less than 4.9% of India's, accounted for almost 20% of all of India's 2,177 June 9 death toll. By contrast, Uttar Pradesh which is on Ivermectin, with 204 million people, three times that of Tamil Nadu, saw a mere 91 deaths, less than 1/4 of Tamil Nadu.

The bottom line is that Ivermectin works, and it works extraordinarily well. You do not need to be a scientist to understand these numbers, as they are self-evident.

Why then does ABC News and Good Morning America need to have a segment entitled "COVID-19 treatment myth about Ivermectin" where they report - falsely - that Ivermectin should not be used and is "dangerous and not advised" to treat COVID-19?

https://www.goodmorningamerica.com/n...ectin-78221949

As a board-certified physician with 39 years of practice, I can tell you this is categorically untrue. Even the WHO has reported Ivermectin to be a safe drug used in billions of doses for over four decades, and no statement like the above could be further from the truth.

This begs the question, Why? What could be the possible reason the primetime major US networks must at this moment break their silence on Ivermectin only to broadcast a bald-faced lie? Why is Good Morning America speaking out on June 11, 2021, about Ivermectin and India of all possible topics? Why do India and Ivermectin suddenly matter to Big Media?

Allow me to shed some light on this question by bringing you back to India for a moment. While GMA was trashing Ivermectin on network primetime US television, India was building it up on an Indian primetime television broadcast to - you guessed it - the people of Tamil Nadu.

On their morning program, "Vanakkam Tamil Nadu," which translates to Good Morning Tamil Nadu, reporter Ravishankar posed a similar question to Dr. Pierre Kory about why the Tamil Nadu health authorities do not support Ivermectin. She said that Tamil Nadu doctors might be watching as Kory delivered his answer.

Dr. Kory paused as he sat in disbelief, "That is a stunning opinion you just shared. Absolutely stunning." See the 6:04 mark on the video:



https://youtu.be/0S8IOttV-Ew

Dr. Kory went on to explain how that opinion was right up there with "the moon landings were faked" or "the earth is flat." He politely suggested they were "isolated" in that opinion because the vast scientific literature on Ivermectin and COVID-19 show it to have unparalleled safety and to be associated with massive and reproducible reductions in mortality.

Five meta-analyses have been completed on Ivermectin. All show a dramatic positive effect. He explained that meta-analysis, the highest form of evidence in medicine, is a pooling of studies that combine all the evidence to generate a unified signal. That signal can only be interpreted in one direction, that Ivermectin must be adopted immediately. Dr. Kory explained how the Tamil Nadu casualties were unnecessary deaths - where the citizens could have been saved with Ivermectin.

The reporter even agreed. "You're right, you're right," she admitted.

But then Dr. Kory bluntly stated the obvious. The true reason is money. If the regulators acknowledged that Ivermectin is effective, then the Emergency Use Authorizations for the vaccines would be revoked. "Many of the vaccines would lose their Emergency Use Authorization if you have an effective treatment. That is a market in the hundred(s) of Billion. And that’s just the vaccines... And the market for Remdesivir…They would all dry up...Ivermectin CANNOT be adopted for that reason."

The WHO is supported to the tune of nearly four billion dollars by the Gates Foundation. Bill Gates is a vaccine proponent. Dr. Tess Lawrie of the British Ivermectin Research and Development Panel (BIRD) recently spoke with Dr. Kory in an interview. They discussed how the sponsor influenced the conclusions - non-scientifically - in key papers on Ivermectin. They further reviewed how numerous studies were eliminated from review and how weak and flawed studies were elevated and overweighted. This was all done with the purpose of twisting the WHO guidelines against Ivermectin to suit their sponsor's interests.



https://youtu.be/WenJhxVWekU

Dr. Kory discussed the concept of Regulatory Capture, a term that applies when a regulatory agency is controlled by the same corporation they are supposed to regulate. In the vaccine situation, it is far worse than the fox guarding the henhouse. It is closer to the fox convincing the farmer to serve him the chicken fried up on a platter.

Big Tobacco cozied up to the FTC, and instead of regulating the industry, the FTC and Congress took money to look the other way and let them off by placing a weak warning label on the pack. The original warning label was supposed to read,

Caution: Cigarette Smoking is Dangerous to Health. It May Cause Death from Cancer and Other Diseases.

However, when greased with enough cash, the warning changed to,

Caution: Cigarette smoking may be hazardous to your health.

The words cancer, cause, and death were expunged. And as everyone knows, this warning label did not save anyone, with the sole exception of the cigarette industry.

https://www.amazon.com/Emperor-All-M.../dp/1439170916

Today is no different. When Johnson and Johnson's vaccine reflected a danger signal of blood clots, their vaccinations were temporarily halted. But like with cigarettes, the CDC and FDA had our backs, and before resuming these mass vaccinations, they dutifully added a warning label. I am confident that everyone reads it carefully before they get their shot.

Dr. Peter McCullough, one of the world's most published cardiologists, called out the dangers of the COVID-19 vaccine. In particular, he warned about the Spike Protein that is produced after a person gets the shot. He spoke in a lengthy interview about the vaccine,

"This is far and away the most lethal, toxic, biologic agent ever injected into a human body in American History, and it is going strong, with no mention of safety by our public officials, with wild enthusiasm by our hospitals and hospital administrators, with doctors supporting it.” See the 1:37:08 mark in this video where he reports this:



Regulatory Capture has been a fact of life for Big Polluters and the EPA and Big Pharma and the FDA. Now it has morphed into grotesque proportions with Big Vaccines and the WHO.

When the WHO looks the other way to suggestions that Communist China intentionally leaked the coronavirus to the world, and when Dr. Fauci's emails suggest he knew last year the virus was likely engineered through testing his own agency funded, and when the evidence points to collusion in suppressing the antidotes for the virus, i.e., repurposed drugs like Ivermectin and HCQ, then what does this say about the urgency of the threat we are now experiencing?

The textbook solutions to the thorny problem of Regulatory Capture have always involved legal remedies. Because when you hold corporations responsible with monetary fines, it sometimes helps. However, the monstrous tobacco settlement produced questionable benefits; cigarettes continue to be sold, and people are still dying from them in droves.

Criminal penalties are the harshest solution, and when you make examples of corporate officers, when heads roll, when people do time, real results follow. Dr. Soumya Swaminathan was served legal papers by the Indian Bar Association for the Tamil Nadu disaster. However, there are ever louder rumblings on this side of the pond that certain US public health authorities will be next.

If the GMA broadcast is any indicator, the time to demand reform is now; the time to halt the vaccine roll-out is at hand. The time to bring an end to the “Plandemic” is at once, for “We are the Prey,” and each of us is merely another dollar sign to Big Media, Big Pharma, and Big Regulators. The gatekeepers have sold us out.
SOURCE: https://www.thedesertreview.com/opin...0d864f627.html

OK, so where can someone actually FIND a legitimate source for medical grade Ivermetin today without violating some law? Or has that been banned and outlawed to keep us from having options other than the vaccines?
 
Old 07-24-2021, 01:36 PM   #852
WebSlave
Yeah, I know this is a conspiracy theory thing, but I've been reading claims here and there that these vaccines contain a substance called "graphene oxide". So I do a Google search and find all sorts of sites debunking this claim, and I start thinking that, yeah, does seem to be pretty bogus. Just on a whim I do the same search on DuckDuckGo.com and well, what do you know....

Quote:
Nano coronavirus recombinant vaccine taking graphene oxide as carrier

Abstract

The invention belongs to the field of nano materials and biomedicine, and relates to a vaccine, in particular to development of 2019-nCoV coronavirus nuclear recombinant nano vaccine. The invention also comprises a preparation method of the vaccine and application of the vaccine in animal experiments. The new corona vaccine contains graphene oxide, carnosine, CpG and new corona virus RBD; binding carnosine, CpG and neocoronavirus RBD on the backbone of graphene oxide; the CpG coding sequence is shown as SEQ ID NO 1; the novel coronavirus RBD refers to a novel coronavirus protein receptor binding region which can generate a high-titer specific antibody aiming at the RBD in a mouse body, and provides a strong support for prevention and treatment of the novel coronavirus.

Description

Nano coronavirus recombinant vaccine taking graphene oxide as carrier
Technical Field
The invention belongs to the field of nano materials and biomedicine, and relates to development of a vaccine development platform. In particular to the development of 2019-nCoV coronavirus nuclear recombinant nano-vaccine. The invention also includes the use of the vaccine in animal testing.

Technical Field

The vaccine is an ultimate weapon for eliminating major infectious diseases, has the advantages of lowest cost and more advantages of prior enemy than other therapies, undoubtedly becomes hopeful to the public, the smallpox is eliminated by human beings through vaccination, the poliomyelitis cases are reduced by 99 percent, the infectious diseases such as diphtheria are rare, and the incidence rate of diseases such as measles, neonatal tetanus and the like is remarkably reduced. The effect of vaccines on human health is not excessive, and the birth of each new vaccine is a great victory for human beings to overcome an infectious disease! To date, no medical treatment has been able to have such an important, lasting and profound effect on human health as a vaccine; nor is any therapeutic available to eliminate a disease from the earth at the very least cost of a vaccine.

After the occurrence of SARS-CoV-2 epidemic, different laboratories in China have completed the isolation of virus strains, and in order to make a big step forward in vaccine development, we believe that we will soon have a final weapon for the eradication of SARS-CoV-2, however, until now there is no approved vaccine or drug for the treatment of CoV infection, and there is a great need to develop an effective drug for the treatment or prevention of coronavirus infection and outbreak.

According to the research of coronavirus vaccines such as SARS and MERS, the main target point of the existing coronavirus vaccine is the S protein of coronavirus. Vaccines need to induce not only humoral and cellular immune responses, but also mucosal immune responses, and with the aid of adjuvants to induce balanced Th1 and Th2 pathways to produce truly effective vaccines. At present, the research of more SARS and MERS vaccines mainly focuses on viral vector vaccines and subunit vaccines, and a large number of researches show that the difficulty of SARS and MERS lies in that long-term memory B cells cannot be stimulated to generate, the long-term memory cells in the healed SARS and MERS patients can only last for 2-3 years, immunological memory cannot be generated, and the vaccine development failure is caused, and only 6 potential coronavirus vaccines enter the clinical research stage at present, but no 1 effective vaccine is approved to be marketed.

Disclosure of Invention

The invention aims to provide a coronavirus recombinant vaccine.

Another purpose of the invention is to provide a preparation method of the virus recombinant vaccine.

It is still another object of the present invention to provide the use of the recombinant vaccine of the virus.

In view of various problems of the conventional vaccines at present, how to change the problems of the existing vaccines and enhance immune response is a problem which is always considered, in order to improve the immunocompetence of the immunogen and enhance the immune response capability of the body, the most basic method is to mix the immunogen with an adjuvant, and the immune adjuvant is a promoter capable of enhancing the immune response of the body to the immunogen. CpG Oligodeoxynucleotide (ODN) is a very promising adjuvant discovered in recent years. CpG ODN has been shown to have better adjuvant activity in vivo, in vitro and clinical studies in animals, and the best studies are CpG7909 and CpG 1018. 11/9.2017, the hepatitis B vaccine approved by Dynavax Technologies of the United states of America FDA and using CpG1018 as an adjuvant is on the market, is the first approved CpG ODN adjuvant vaccine in the world and is used for preventing HBV infection of adults 18 years old and older, and a plurality of different types of CpG ODN are used as adjuvants in a plurality of clinical trials. CpG is combined with TLR9 to activate immature pDC cells and induce natural and adaptive immune response, but a single CpG structure has limited activation effect on immune cells and is easy to be rapidly hydrolyzed by exonuclease, so that the stability of the CpG in vivo is insufficient, and side effects are also caused; CpG Oligodeoxynucleotide (ODN) synthesized in the sequence can also enhance the stimulation effect, and after the CpG is coupled with other proteins such as antigen and the like, the CpG oligodeoxynucleotide is combined, so that the CpG oligodeoxynucleotide has a very obvious immune activation effect.

Graphene is a two-dimensional carbon nanomaterial consisting of carbon atoms in sp hybridized orbitals in a hexagonal honeycomb lattice. The basic structural unit of the material is the most stable benzene six-membered ring in the organic material, and the material is the most ideal two-dimensional material at present. Graphene Oxide (GO) is a Graphene oxide derivative, and is a exfoliated product. Due to the characteristics of unique SP2 hybridization, a perfect two-dimensional structure and high reactivity of the edge, the treatment platform based on the hybrid structure can be used as an ideal load and grafting carrier in design and development, and plays an important role in aspects of nano-drug delivery systems, biological detection, tumor treatment, cell imaging and the like.

The present invention has been completed based on the above-mentioned studies.

The invention discloses a brand-new vaccine development method based on a graphene oxide material serving as a framework for loading CpG molecules and recombinant proteins. Based on the technical platform, a new nano new crown vaccine is prepared by combining the recombinant protein of the RBD region of the Spike protein of the SAR-CoV-2. The prepared nano new corona vaccine has stronger immunogenicity in mouse experiments and can generate high-titer antibodies.

In one aspect, the invention provides a coronavirus vaccine comprising graphene oxide, carnosine, CpG, and RBD. In a preferred embodiment of the invention, the vaccine is named GO-Car-carnosine-CpG-RBD vaccine.

Graphene Oxide (GO) is an oxide of graphene, and after oxidation, oxygen-containing functional groups on the graphene oxide are increased, so that the graphene oxide is more active than graphene. For example, hydroxyl groups and epoxy groups are randomly distributed on a graphene oxide monolith, while carboxyl groups and carbonyl groups are introduced at the edge of the monolith. Common commercial products of graphene oxide are in the form of powder, flakes and solutions, and are brown-yellow in color.

Carnosine, known by the scientific name β -alanyl-L-histidine, is a crystalline solid composed of a dipeptide consisting of two amino acids, β -alanine and L-histidine. Carnosine has strong antioxidant ability, and can scavenge Reactive Oxygen Species (ROS) and alpha-beta unsaturated aldehydes, which are formed by over-oxidation of fatty acids in cell membranes during oxidative stress.

CpG motifs have the effect of activating the body's immune system and can be used as adjuvants. Preferably, the CpG coding sequence is shown as SEQ ID NO 1.

RBD (spike receptor binding domain), specifically a coronavirus protein (S protein) Receptor Binding Domain (RBD) in the present invention. For example, the RBD protein can be selected as follows:

PNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKC YGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDF TGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTP CNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAP(SEQ ID NO 2)。

the coronavirus vaccine disclosed by the invention is obtained by combining carnosine, CpG and a novel coronavirus RBD on activated graphene oxide.

The dosage of GO in the coronavirus vaccine provided by the invention is used as a framework base, the dosage is usually excessive, and the dosage of carnosine can be about twice of that of GO. CpG and new coronavirus RBD are used as biological macromolecules, and the dosage of the CpG and the new coronavirus RBD is less, and is usually one ten thousandth of that of GO in mass ratio. And RBD is used in an amount more than 2 times that of CpG, such as CpG: RBD = 1: 2-10, preferably, the dosage of RBD is 3-6 times of that of CpG.

In another aspect, the present invention provides a method for preparing the coronavirus vaccine, the method comprising the steps of:

obtaining CpG, RBD recombinant protein and carnosine;

adding freeze-dried GO powder into a phosphate buffer solution, and carrying out ultrasonic treatment;

adding EDC and NHS to activate GO solution, removing excess EDC/sulfo-NHS in the reaction solution through ultrafiltration, and adjusting the pH of the reaction solution to be neutral;

adding carnosine, CpG, and RBD recombinant proteins to the reaction solution, incubating with activated GO;

excess unconjugated protein was removed from the reaction solution and sterilized for use.

Preferably, the duration of the ultrasound is 2 to 3 hours. The ultrasonic conditions were 200W, 40 kHz.

Preferably, the phosphate buffer has a neutral pH, e.g., 6.8 to 7.6, more preferably 7.0 to 7.4, or 7.2.

Preferably, the method of removing excess EDC/sulfo-NHS or unconjugated protein is ultrafiltration.

In a preferred embodiment of the present invention, the ratio of graphene oxide, carnosine, CpG, and RBD is: 26 mg: 40 mg: 1.2. mu.g: (3-6) μ g.

Preferably, the reaction temperature is 20-28 ℃. For example, room temperature is used.

In a preferred embodiment of the present invention, the GO-Car-carnosine-CpG-RBD vaccine is prepared by the following method: GO was coupled to carnosine using a modification of the EDC-NHS reaction, 26mg of GO lyophilized powder was added to 5.20 mL of phosphate buffer (PBS, pH = 7.4) and sonicated (200W, 40 kHz) at 25 ℃ for 3 h. The GO solution was activated by the addition of 6.82 mg EDC (N1- ((ethylimino) methyl-ene) -N3, N3-dimethyl propane-1,3-diamine, Chinese: 1- (3-dimethylaminopropyl) -3-ethylcarbodiimide) and 7.73 mg NHS (N-N-hydroxysuccinimide) at 25 ℃. Excess EDC/sulfo-NHS was removed from the reaction solution by ultrafiltration and the pH of the solution was then adjusted to 7.4. Then, 40mg of carnosine, 1.2ug CpG, and various concentrations of RBD recombinant protein were added to the solution and reacted with activated GO at 25 ℃ for 2 h. Subsequently, excess unconjugated protein was removed from the reaction solution by ultrafiltration. The prepared product is marked as GO-Car-carnosine-CpG-RBD vaccine. Finally, GO-Car-carnosine-CpG-RBD vaccine solution was contacted with sterile filter (0.22 um) and stored in sterile containers at 4 ℃ for subsequent experiments.

The invention establishes a nano recombinant protein vaccine preparation technical platform capable of quickly exciting the human immune system, and can quickly produce a large amount of preventive vaccines after infectious viruses are confirmed. The technical platform fully utilizes the characteristic that the surface of graphene oxide is provided with COOH, hydroxyl and other groups, and utilizes the interaction between pi-pi bonds to assemble the screened RBD recombinant protein, CpG molecules and carnosine together to prepare the nano recombinant protein vaccine based on the graphene oxide as the framework. The vaccine can stimulate an organism to generate a high-titer RBD neutralizing antibody aiming at SAR-CoV-2, and lays a technical foundation for preventing and treating coronavirus infection and future large outbreaks of similar epidemics.

In another aspect, the invention provides an application of the GO-Car-carnosine-CpG-RBD vaccine, namely an application of the GO-Car-carnosine-CpG-RBD vaccine in preparation of a medicine for preventing a new coronavirus.

Preferably, the application of the composition can improve the immunity of organisms to the new coronavirus.

Preferably, the GO-Car-carnosine-CpG-RBD vaccine can generate specific antibodies aiming at RBD, and the specific antibody titer is high. In the embodiment of the invention, the nano neocorona vaccine realizes stronger immunogenicity in a mouse test and can generate high-titer antibodies.

The invention has the beneficial effects that:

a brand-new vaccine technical platform is developed for a framework loaded CpG molecule and recombinant protein based on a graphene oxide material and combined with the recombinant protein of the RBD region of the Spike protein of SAR-CoV-2 to prepare a novel nano coronavirus vaccine, a high-titer specific antibody aiming at the RBD can be generated in a mouse body, and a strong support is provided for prevention and treatment of novel coronavirus.

Drawings

In order to more clearly illustrate the technical solutions in the embodiments of the present application, the drawings needed to be used in the embodiments will be briefly described below, and it is obvious that the drawings in the following description are only some embodiments of the present application, and it is obvious for those skilled in the art to obtain other drawings without creative efforts.

FIG. 1 is a schematic diagram and time schematic representation of GO-Car-carnosine-CpG-RBD vaccine mouse immunization;

FIG. 2 shows the change of specific RBD antibody in serum 28 days after the mice were immunized and the change of cytokine production by spleen cells 42 days after the mice were immunized.

Detailed Description

The technical solutions in the embodiments of the present application will be described clearly and completely below, and it should be understood that the described embodiments are only a part of the embodiments of the present application, and not all embodiments. All other embodiments, which can be derived by a person skilled in the art from the embodiments given herein without making any creative effort, shall fall within the protection scope of the present application. Methods and techniques not specifically described may be performed using techniques conventionally known in the art. For example, refer to molecular cloning handbook of cold spring harbor.

Example 1

Preparation process of Graphene Oxide (GO) -carnosine-CpG-RBD recombinant protein vaccine preparation

Selecting a TLR9 receptor nucleic acid sequence CpG ODN M362 which has cross reaction to both human and mouse, wherein the specific sequence is as follows: 5 '-TCGTCGTCGTTC: GAACGACGTTGAT-3' (25 mer, SEQ ID NO 1), coupling GO with carnosine using a modification of the EDC-NHS reaction, 26mg of a lyophilized powder of GO was added to 5.20 mL of phosphate buffer (PBS, pH = 7.4) and sonicated (200W, 40 kHz) at 25 ℃ for 3 h. The GO solution was activated by the addition of 6.82 mg EDC (N1- ((ethylimino) methyl-ene) -N3, N3-dimethyl propane-1,3-diamine, Chinese: 1- (3-dimethylaminopropyl) -3-ethylcarbodiimide) and 7.73 mg NHS (N-N-hydroxysuccinimide) at 25 ℃. Excess EDC/sulfo-NHS was removed from the reaction solution by ultrafiltration and the pH of the solution was then adjusted to 7.4. Then, 40mg of carnosine, 1.2ug CpG, and various concentrations of RBD recombinant protein were added to the solution and reacted with activated GO at 25 ℃ for 2 h. Subsequently, excess unconjugated protein was removed from the reaction solution by ultrafiltration. The prepared product is marked as GO-Car-carnosine-CpG-RBD vaccine. Finally, GO-Car-carnosine-CpG-RBD vaccine solution was contacted with sterile filter (0.22 um) and stored in sterile containers at 4 ℃ for subsequent experiments.

Example 2

Test of Graphene Oxide (GO) -carnosine-CpG-RBD recombinant protein vaccine immunized mice

6-week-old female BALB/c mice were immunized by subcutaneous injection at 0, 14, and 28 days, respectively, for 28 days and 42 days according to the schedule shown in FIG. 1, blood was collected by drawing blood at , and serum was separated and tested for specific antibodies against RBD. Mice were sacrificed at 42 days, splenocytes isolated, and tested for specific T cell immune responses and cytokine secretion.

Grouping and dose determination of immunized mice:

1. (graphene oxide + carnosine) + 1.2ug cpG +3ug RBD

(graphene oxide + carnosine) + 1.2ug cpG +6ug RBD

3. Aluminum hydroxide +6ug RBD (1: 1)

4. 6ug RBD

5. Liposome (lipo) +6ug RBD group

Mouse strains: BALB/c mic (n = 6).

The schedule for immunization of mice with the GO-Car-carnosine-CpG-RBD vaccine is: blood was collected and first immunized as starting point for immunization of mice. And (5) collecting blood for the second time on the 7 th day, and inspecting a new corona virus adding system to master the principle. Collecting blood for the third time on day 14, and enhancing immunity. Collecting blood for the fourth time on day 28, enhancing immunity, detecting antibody in serum, and if positive, preparing to collect spleen cells. The fifth blood collection on day 42, after which the blood was sacrificed and splenocytes were isolated and subjected to cytokine experiments.

The test results show that 3ug and 6ug groups of the GO-Car-carnosine-CpG-RBD vaccine generate high-titer specific antibodies for RBD after mice are immunized, and the GO-Car-carnosine-CpG-RBD vaccine is significantly different from the traditional adjuvant group, the RBD group and the liposome group (figure 2). Further analyzing the specific immune response of the T cells separated from the spleen, the result shows that the GO-Car-carnosine-CpG-RBD vaccine can stimulate the organism to generate specific IFN-gamma cytokines, improve the immunity of the organism and resist the epidemic situation of new coronavirus.

The above description is only for the specific embodiments of the present application, but the scope of the present application is not limited thereto, and any changes or substitutions that can be easily conceived by those skilled in the art within the technical scope of the present disclosure should be covered within the scope of the present application. Therefore, the protection scope of the present application shall be subject to the protection scope of the claims.

SOURCE: https://patents.google.com/patent/CN112220919A/en

BTW, my eyes glazed over reading this stuff, as it is WAY over my head. But still...

Interesting, no? Apparently Google has a stake in this COVID vaccine game.

IMHO.

 
Old 07-24-2021, 01:52 PM   #853
WebSlave
Just for chuckles, do your own search engine search on the phrase "graphene oxide" using both Google.com and DuckDuckGo.com. The differences in results are interesting.

Did you notice that graphene oxide has magnetic properties?
 
Old 07-24-2021, 07:25 PM   #854
WebSlave
So, what is graphene oxide?

Glad you asked.

Quote:
Graphene Oxide Blockbuster: It Causes CV Symptoms and is Present in all Aspects of Diagnosis and Treatment

July 19, 2021 TLB Staff HEALTH, Spotlight, Tyranny, WORLD

ER Editor: See these earlier articles we published on the graphene oxide discovery, which has been used to explain why vaccine recipients appear to be magnetic:

Analysis of Vaccination Vial Confirms Presence of Graphene Nanoparticles [VIDEO] and Graphene Quantum Dot Detectors for Health-Monitoring ‘Wearables’.

Originally, we had wondered which vaccine they were referring to. This video confirms it’s the mRNA type (Pfizer in particular) that contains this substance. But this interview goes further, claiming that graphene oxide is CAUSING COVID SYMPTOMS, and has been found to be present in each and every step of diagnosis and treatment. And 5G has a role to play …

***

We do not subscribe to the ‘everything is reducible to graphene’ theory. As we have published on extensively, something (or several things) of a pulmonary nature was circulating way back in 2019, producing a slightly different type of pulmonary fibrosis, according to a Taiwanese virologist who alerted the CDC because of cases found on US soil and got the brush off. In March 2020 in France, as in many places, there was something of a respiratory nature going around that a few susceptible people we know got, people who don’t get flu or suffer from lung problems. Some of these symptoms were a little unusual (upper respiratory tract burning, and a curious return of symptoms after 15 days – which appeared in the French govt’s list of symptoms at the time) but which have NEVER BEEN INCLUDED in the official, SURVIVING list of COVID symptoms, which we find exceedingly strange. There were no graphene-containing masks, PCR tests or vaccines at that point. We do subscribe to the multiple bioweapon theory (which they don’t want identified and sequenced for obvious reasons), with graphene additives inserted along the way to keep the virus scare/symptoms alive. And to justify multiple, annual vaccines.

If graphene in the vaccines is causing Covid symptoms, then haven’t the vaccines been weaponized in TWO ways? First, through graphene, and second through causing massive spike protein production, which is also toxic.

***

Curiously, this research is, so far, only being conducted in Spain and Chile.

***

There is an interesting 25-minute video interview below with Prof. Michel Chossudovsky and Ricardo Delgado Martin. Here we offer some notes but recommend listening to the interview:
  • First off, we emphasize the interviewer’s words: people, through the graphene in the vaccine, are transformed into ‘super conductors’ capable of ‘storing energy’.
  • At least 90 scientific studies show the toxic effect of graphene oxide in the human body; graphene has been shown to produce the same clinical EFFECTS of COVID, such as bloodclotting and consequent reduction of platelets. It also affects the immune system through oxidative stress and triggers the collapse of the immune system through the cytokine storm, inflammation of mucous membranes, and loss of taste and smell. This is the classic Covid picture. So is graphene the CAUSALITY of these symptoms, as well as the 17,000 EU deaths that have been reported and many thousands in the US? Ricardo Delgado believes this to be true. (Delgado also reminds us that only around 1% of deaths and adverse events ever get reported.)
  • Masks also contain graphene, which could adversely impact the health of wearers. A report from Health Canada now says, one year later, that the masks containing graphene should be removed and there was a recall of millions of masks. In mask wearers, this can cause pulmonary fibrosis and cancer. So – how can this be injected into people in sufficiently high quantities via the vaccines? It isn’t just at a low level within the vaccine, as is the case for an adjuvant: it is the main component. WHAT HAS BEEN PUT IN THE VACCINE TO SUPPOSEDLY PREVENT THE DISEASE IS WHAT IS PROVOKING IT.
  • Chossudovsky: so you are almost making the case that it is a toxic element causing the disease, not the virus. Today, we still lack a scientific description (sequencing and isolation) of the virus. The PCR test with the WHO uses the IDENTITY OF THE SARS-CoV (original) VIRUS. So has SARS-CoV 2 been created to cover up the REAL cause of mortality? The routes of toxicity are the masks, the PCR test and the vaccines. ‘As of today, there is no global institution that has recognized the actual isolation, sequencing or purification of the biological agent called SARS-CoV-2, of a novel coronavirus. There is only a virtual sequencing in a computer assembled with a computer algorithm from 3 samples of alveolar mucus taken from 3 patients with pneumonia in the city of Wuhan … in nature, SARS-CoV 2, the new coronavirus, does not exist.’ The symptoms of the virus are caused by graphene. The PCR test cannot find it.
  • The cotton part of the swab in the PCR test also contains graphene. A Turkish company that produces intranasal vaccines is also producing swabs with graphene in the cotton. So what is being used for ‘prevention’ and ‘diagnosis’ also contains elements that will later cause the disease.
  • Graphene, when it comes into contact with human (living) cells containing hydrogen, has magnetic properties. This magnetic effect of the vaccines has been confirmed using appropriate scientific instrumentation and shown through millions of videos and pieces of evidence. Magnetism is also showing up in people who have been using the masks for a long time but are NOT VACCINATED. Graphene is present in each of the steps along the way – masks, tests, vaccines.
  • Graphene oxide has a certain magnetic resonance band, beyond which it becomes excited, which in turn leads to rapid oxydisation of the material. When the oxydisation level exceeds certain body biomarkers, it triggers a collapse of the immune system and a cytokine storm, typical of ‘severe Covid-19’.
  • Chossudovsky: Some health organization or entity (WHO) has approved items such as masks, (PCR tests) and vaccines. And 190 nations belonging to the UN have approved what the WHO decides. Virologists in other countries have accepted a series of concepts that haven’t been proven – they haven’t done this type of analysis. That’s the first question. The second is, what are the solutions for the public, especially those vaccinated, and for the various health authorities? Answer: with graphene oxide, we know how to degrade it by increasing a person’s glutathione levels. So treatments with N-acetylcysteine, a precursor to glutathione work, as well as IV shots of glutathione. We must raise our antioxidant levels of glutathione. This effect has been seen in at least 96 clinical trials. We must also avoid the vaccine because it will potentially cause the disease later, involving bloodclotting. Subsequent doses for those vaccinated mustn’t be taken. We are capable of discharging graphene oxide, so it’s curious they’re recommending several vaccines a year. Athletes and children have naturally high glutathione levels. The elderly have low levels.
  • The vaccines have been shown to contain MINIMAL mRNA, yet significant levels of graphene.
  • In various jurisdictions in Spain, lawsuits have been started to stop the vaccines.
  • Chilean researchers have also found graphene oxide in the Astra Zeneca vaccine.
  • Was all this virus scare brought about to inject the neurological modulator graphene oxide into the population? We’re talking about neuronal control. Graphene behaves inside the body as a nano-biosensor. And from there, graphene oxide can be excited wirelessly and remotely with 5G technology, which has never stopped being implemented during the pandemic.

********

Video: Graphene Oxide: A Toxic Substance in the Vial of the COVID-19 mRNA Vaccine
SOURCE: https://www.thelibertybeacon.com/gra...and-treatment/

Also of interest, this site has more info but honestly was a bit much for me to read right now:

Graphene Oxide Particles in Covid mRNA “Vaccines” Causing Magnetism?


 
Old 07-26-2021, 02:05 AM   #855
WebSlave
Here is an interesting site showing the relative effectiveness of various drugs used to combat COVID.

https://c19early.com/
 
Old 07-26-2021, 02:44 PM   #856
Lucille
Quote:
Originally Posted by WebSlave View Post
I hope there are no further side effects, April.

I am curious about how adamant the government is going to be about trying to get ~100% of the population vaccinated. I am waiting for the notice that mine and Connie's social security payments and Medicare coverage will be suspended until we get the vaccination. I haven't heard anyone mention this yet, but it would be a logical step for them to take to force compliance, if that is their goal. For the good of us old codgers, of course. I would bet that it has at least been discussed behind closed doors.
April I hope you have recovered completely from the vaccine.

In the first Federal step toward forced compliance, Department of Veteran's Affairs health care workers will now be required to be vaccinated. That seems to be a pretty easy sell to the public, but it opens the door to further mandates.

Quote:
Originally Posted by WebSlave View Post
Apparently she is feeling VERY ill right now. And yes, she has been vaccinated.
I hope she comes though fine, my thoughts and prayers are with her. Apparently the vaccine supposedly protects against serious illness and death, but they classify 'serious' as the need for hospitalization,ventilators, one can feel very ill with just a 'regular' case of Covid, I did.

Quote:
Originally Posted by WebSlave View Post
SOURCE: https://www.thedesertreview.com/opin...0d864f627.html

OK, so where can someone actually FIND a legitimate source for medical grade Ivermetin today without violating some law?
I have bought Ivermectin cheap at Walmart and at feed stores. While not 'medical grade', people use it for pets and dogs, and as long as dosage recommendations are followed I have heard no disastrous reports of pets dying.

I just checked, and Amazon has both the medical grade (prescription required) and veterinary grade (no prescription) Ivermectin.
 
Old 07-29-2021, 11:14 AM   #857
WebSlave
Quote:
Top health expert says vaccinated people are spreading delta variant

By Alexandra Kelley | July 7, 2021


Story at a glance
  • Christopher Murray said that vaccinated individuals may be contributing to the spread of COVID-19.
  • As the delta variant becomes the most dominant strain, Murray posits that not testing vaccinated individuals may overlook possible transmission points.
  • New data suggests that the delta variant may also be more resilient to the Pfizer vaccine.

As some states report marked upticks in COVID-19 infections while the delta variant becomes the most common strain in the U.S., public health experts are encouraging further vaccinations to help curb transmission.

Some experts, however, warn that vaccinated individuals may still be capable of contracting and transmitting COVID-19.

Speaking to Insider, Christopher Murray, the director of the Institute for Health Metrics and Evaluation, said that not testing vaccinated people — as the U.S. Centers for Disease Control and Prevention (CDC) recommends — may be overlooking some transmission.

"We actually have states where hospitalizations are going up more than cases," Murray said, adding that "we're probably missing a bunch of transmission in vaccinated individuals."

National data notes that more than 30 states continue to see rises in the number of COVID-19 infections. Experts attribute this to gaps in vaccinations and the rise of the contagious delta variant.

While vaccines are beneficial in preventing severe infections, contracting the virus and transmitting COVID-19, vaccinated individuals are never completely protected against COVID-19. Breakthrough infections are possible, and the delta infectivity rate is still very high.

"That's the scary part," said Hugh Cassiere, director of critical care services at the Sandra Atlas Bass Heart Hospital at North Shore University Hospital, on Long Island, New York, to NBC. "Delta has such a high infectivity rate."

Other data emerging from Israel suggest that the Pfizer vaccine is less effective against infections caused by the delta variant, which may explain the uptick in U.S. infection despite widespread vaccinations.
SOURCE: https://thehill.com/changing-america...-are-spreading
 
Old 07-29-2021, 01:11 PM   #858
WebSlave
Quote:
Originally Posted by Lucille View Post
In the first Federal step toward forced compliance, Department of Veteran's Affairs health care workers will now be required to be vaccinated. That seems to be a pretty easy sell to the public, but it opens the door to further mandates.
I just read that Google and Facebook are requiring their workers to be vaccinated. I wonder if those employers will incur liabilities for any of their workers that may suffer side or after effects from the vaccines?

I believe federal employees will be facing the same requirements soon.

This sure does smack of the "Mark of the Devil" stuff, doesn't it?

Quote:
Originally Posted by Lucille View Post
I hope she comes though fine, my thoughts and prayers are with her. Apparently the vaccine supposedly protects against serious illness and death, but they classify 'serious' as the need for hospitalization,ventilators, one can feel very ill with just a 'regular' case of Covid, I did.
The vaccinated can still catch and transmit the virus. And many of those vaccinated act like they are now immune and can go back to the pre-COVID days in how they socialize with others. This is just dangerous, IMHO.

As for "serious illnesses" in the vaccinated, well...

https://www.brighteon.com/82932c26-9...3-6d458d3107df

Quote:
Originally Posted by Lucille View Post
I have bought Ivermectin cheap at Walmart and at feed stores. While not 'medical grade', people use it for pets and dogs, and as long as dosage recommendations are followed I have heard no disastrous reports of pets dying.

I just checked, and Amazon has both the medical grade (prescription required) and veterinary grade (no prescription) Ivermectin.
Yeah, I have seen that, but it seems the veterinary grade Ivermectin generally comes in paste form. Eating an Ivermectin sandwich doesn't sound all that appetizing to me. And I would have no idea about what a correct dosage would be. I have heard of the possibility of getting Ivermectin from off shore sources but many such sources are so chock full of scammers that I doubt I would trust very many of them.

I am having a lot of trouble keeping a positive slant in my talks with Connie trying to convince her that things will get better. It is rather difficult trying to remain sane in an insane world.
 
Old 07-30-2021, 06:37 PM   #859
WebSlave
Quote:
Originally Posted by WebSlave View Post
Connie just learned that someone on her side of the family tree has just been tested for COVID after coming back from a trip with other members of the family. When she came back from the trip on Sunday she started feeling ill, like she was coming down with a cold. So she got tested and the test came back positive. Apparently she is feeling VERY ill right now. And yes, she has been vaccinated.

And other person in the family along during that trip is also feeling ill now too, and she also has had the vaccine. So there are more people in the family planning on getting tested for COVID right now too.
So, the family member of Connie's mentioned above left this past Wednesday on a 6 week trip to the northeast with a significant other in their motorhome. BTW, she was tested POSITIVE for COVID, in case that wasn't made clear by my ramblings. So much for staying in quarantine. I don't think either one of them fully understands that they are NOT immune to catching COVID (which should have been proved to them VERY recently) nor are they immune to infecting others with it.

I know I have said this before, but if the world actually faces a pandemic with a significant kill ratio, we are ALL screwed. The world just isn't designed, nor most people inclined, to be able to do what is necessary to keep a contagion from spreading far and wide. If COVID was just a test, humanity has failed miserably. It just seems that so many people have used it as a pretext to jockey for position for power and/or profit instead of any realistic concern for anyone else.
 
Old 08-01-2021, 01:41 PM   #860
WebSlave
Quote:
Outbreak of SARS-CoV-2 Infections, Including COVID-19 Vaccine Breakthrough Infections, Associated with Large Public Gatherings — Barnstable County, Massachusetts, July 2021

Early Release / July 30, 2021 / 70

Catherine M. Brown, DVM1; Johanna Vostok, MPH1; Hillary Johnson, MHS1; Meagan Burns, MPH1; Radhika Gharpure, DVM2; Samira Sami, DrPH2; Rebecca T. Sabo, MPH2; Noemi Hall, PhD2; Anne Foreman, PhD2; Petra L. Schubert, MPH1; Glen R. Gallagher, PhD1; Timelia Fink1; Lawrence C. Madoff, MD1; Stacey B. Gabriel, PhD3; Bronwyn MacInnis, PhD3; Daniel J. Park, PhD3; Katherine J. Siddle, PhD3; Vaira Harik, MS4; Deirdre Arvidson, MSN4; Taylor Brock-Fisher, MSc5; Molly Dunn, DVM5; Amanda Kearns5; A. Scott Laney, PhD2

Summary
What is already known about this topic?

Variants of SARS-CoV-2 continue to emerge. The B.1.617.2 (Delta) variant is highly transmissible.

What is added by this report?

In July 2021, following multiple large public events in a Barnstable County, Massachusetts, town, 469 COVID-19 cases were identified among Massachusetts residents who had traveled to the town during July 3–17; 346 (74%) occurred in fully vaccinated persons. Testing identified the Delta variant in 90% of specimens from 133 patients. Cycle threshold values were similar among specimens from patients who were fully vaccinated and those who were not.

What are the implications for public health practice?

Jurisdictions might consider expanded prevention strategies, including universal masking in indoor public settings, particularly for large public gatherings that include travelers from many areas with differing levels of SARS-CoV-2 transmission.
During July 2021, 469 cases of COVID-19 associated with multiple summer events and large public gatherings in a town in Barnstable County, Massachusetts, were identified among Massachusetts residents; vaccination coverage among eligible Massachusetts residents was 69%. Approximately three quarters (346; 74%) of cases occurred in fully vaccinated persons (those who had completed a 2-dose course of mRNA vaccine [Pfizer-BioNTech or Moderna] or had received a single dose of Janssen [Johnson & Johnson] vaccine ≥14 days before exposure). Genomic sequencing of specimens from 133 patients identified the B.1.617.2 (Delta) variant of SARS-CoV-2, the virus that causes COVID-19, in 119 (89%) and the Delta AY.3 sublineage in one (1%). Overall, 274 (79%) vaccinated patients with breakthrough infection were symptomatic. Among five COVID-19 patients who were hospitalized, four were fully vaccinated; no deaths were reported. Real-time reverse transcription–polymerase chain reaction (RT-PCR) cycle threshold (Ct) values in specimens from 127 vaccinated persons with breakthrough cases were similar to those from 84 persons who were unvaccinated, not fully vaccinated, or whose vaccination status was unknown (median = 22.77 and 21.54, respectively). The Delta variant of SARS-CoV-2 is highly transmissible (1); vaccination is the most important strategy to prevent severe illness and death. On July 27, CDC recommended that all persons, including those who are fully vaccinated, should wear masks in indoor public settings in areas where COVID-19 transmission is high or substantial.* Findings from this investigation suggest that even jurisdictions without substantial or high COVID-19 transmission might consider expanding prevention strategies, including masking in indoor public settings regardless of vaccination status, given the potential risk of infection during attendance at large public gatherings that include travelers from many areas with differing levels of transmission.

During July 3–17, 2021, multiple summer events and large public gatherings were held in a town in Barnstable County, Massachusetts, that attracted thousands of tourists from across the United States. Beginning July 10, the Massachusetts Department of Public Health (MA DPH) received reports of an increase in COVID-19 cases among persons who reside in or recently visited Barnstable County, including in fully vaccinated persons. Persons with COVID-19 reported attending densely packed indoor and outdoor events at venues that included bars, restaurants, guest houses, and rental homes. On July 3, MA DPH had reported a 14-day average COVID-19 incidence of zero cases per 100,000 persons per day in residents of the town in Barnstable County; by July 17, the 14-day average incidence increased to 177 cases per 100,000 persons per day in residents of the town (2).

During July 10–26, using travel history data from the state COVID-19 surveillance system, MA DPH identified a cluster of cases among Massachusetts residents. Additional cases were identified by local health jurisdictions through case investigation. COVID-19 cases were matched with the state immunization registry. A cluster-associated case was defined as receipt of a positive SARS-CoV-2 test (nucleic acid amplification or antigen) result ≤14 days after travel to or residence in the town in Barnstable County since July 3. COVID-19 vaccine breakthrough cases were those in fully vaccinated Massachusetts residents (those with documentation from the state immunization registry of completion of COVID-19 vaccination as recommended by the Advisory Committee on Immunization Practices,† ≥14 days before exposure). Specimens were submitted for whole genome sequencing§ to either the Massachusetts State Public Health Laboratory or the Broad Institute of the Massachusetts Institute of Technology and Harvard University. Ct values were obtained for 211 specimens tested using a noncommercial real-time RT-PCR panel for SARS-CoV-2 performed under Emergency Use Authorization at the Broad Institute Clinical Research Sequencing Platform. On July 15, MA DPH issued the first of two Epidemic Information Exchange notifications to identify additional cases among residents of U.S. jurisdictions outside Massachusetts associated with recent travel to the town in Barnstable County during July 2021. This activity was reviewed by CDC and was conducted consistent with applicable federal law and CDC policy.¶

By July 26, a total of 469 COVID-19 cases were identified among Massachusetts residents; dates of positive specimen collection ranged from July 6 through July 25 (Figure 1). Most cases occurred in males (85%); median age was 40 years (range = <1–76 years). Nearly one half (199; 42%) reported residence in the town in Barnstable County. Overall, 346 (74%) persons with COVID-19 reported symptoms consistent with COVID-19.** Five were hospitalized; as of July 27, no deaths were reported. One hospitalized patient (age range = 50–59 years) was not vaccinated and had multiple underlying medical conditions.†† Four additional, fully vaccinated patients§§ aged 20–70 years were also hospitalized, two of whom had underlying medical conditions. Initial genomic sequencing of specimens from 133 patients identified the Delta variant in 119 (89%) cases and the Delta AY.3 sublineage in one (1%) case; genomic sequencing was not successful for 13 (10%) specimens.

Among the 469 cases in Massachusetts residents, 346 (74%) occurred in persons who were fully vaccinated; of these, 301 (87%) were male, with a median age of 42 years. Vaccine products received by persons experiencing breakthrough infections were Pfizer-BioNTech (159; 46%), Moderna (131; 38%), and Janssen (56; 16%); among fully vaccinated persons in the Massachusetts general population, 56% had received Pfizer-BioNTech, 38% had received Moderna, and 7% had received Janssen vaccine products. Among persons with breakthrough infection, 274 (79%) reported signs or symptoms, with the most common being cough, headache, sore throat, myalgia, and fever. Among fully vaccinated symptomatic persons, the median interval from completion of ≥14 days after the final vaccine dose to symptom onset was 86 days (range = 6–178 days). Among persons with breakthrough infection, four (1.2%) were hospitalized, and no deaths were reported. Real-time RT-PCR Ct values in specimens from 127 fully vaccinated patients (median = 22.77) were similar to those among 84 patients who were unvaccinated, not fully vaccinated, or whose vaccination status was unknown (median = 21.54) (Figure 2).

Transmission mitigation measures included broadening testing recommendations for persons with travel or close contact with a cluster-associated case, irrespective of vaccination status; local recommendations for mask use in indoor settings, irrespective of vaccination status; deployment of state-funded mobile testing and vaccination units in the town in Barnstable County; and informational outreach to visitors and residents. In this tourism-focused community, the Community Tracing Collaborative¶¶ conducted outreach to hospitality workers, an international workforce requiring messaging in multiple languages.

The call from MA DPH for cases resulted in additional reports of cases among residents of 22 other states who had traveled to the town in Barnstable County during July 3–17, as well as reports of secondary transmission; further analyses are ongoing. As of July 3, estimated COVID-19 vaccination coverage among the eligible population in Massachusetts was 69% (3). Further investigations and characterization of breakthrough infections and vaccine effectiveness among this highly vaccinated population are ongoing.

Discussion

The SARS-CoV-2 Delta variant is highly transmissible (1), and understanding determinants of transmission, including human behavior and vaccine effectiveness, is critical to developing prevention strategies. Multipronged prevention strategies are needed to reduce COVID-19–related morbidity and mortality (4).

The findings in this report are subject to at least four limitations. First, data from this report are insufficient to draw conclusions about the effectiveness of COVID-19 vaccines against SARS-CoV-2, including the Delta variant, during this outbreak. As population-level vaccination coverage increases, vaccinated persons are likely to represent a larger proportion of COVID-19 cases. Second, asymptomatic breakthrough infections might be underrepresented because of detection bias. Third, demographics of cases likely reflect those of attendees at the public gatherings, as events were marketed to adult male participants; further study is underway to identify other population characteristics among cases, such as additional demographic characteristics and underlying health conditions including immunocompromising conditions.*** MA DPH, CDC, and affected jurisdictions are collaborating in this response; MA DPH is conducting additional case investigations, obtaining samples for genomic sequencing, and linking case information with laboratory data and vaccination history. Finally, Ct values obtained with SARS-CoV-2 qualitative RT-PCR diagnostic tests might provide a crude correlation to the amount of virus present in a sample and can also be affected by factors other than viral load.††† Although the assay used in this investigation was not validated to provide quantitative results, there was no significant difference between the Ct values of samples collected from breakthrough cases and the other cases. This might mean that the viral load of vaccinated and unvaccinated persons infected with SARS-CoV-2 is also similar. However, microbiological studies are required to confirm these findings.

Event organizers and local health jurisdictions should continually assess the need for additional measures, including limiting capacity at gatherings or event postponement, based on current rates of COVID-19 transmission, population vaccination coverage, and other factors.§§§ On July 27, CDC released recommendations that all persons, including those who are fully vaccinated, should wear masks in indoor public settings in areas where COVID-19 transmission is high or substantial. Findings from this investigation suggest that even jurisdictions without substantial or high COVID-19 transmission might consider expanding prevention strategies, including masking in indoor public settings regardless of vaccination status, given the potential risk of infection during attendance at large public gatherings that include travelers from many areas with differing levels of transmission.

Acknowledgments

Hanna Shephard, Geena Chiumento, Nicole Medina, Juliana Jacoboski, Julie Coco, Andrew Lang, Matthew Doucette, Sandra Smole, Patricia Kludt, Natalie Morgenstern, Kevin Cranston, Ryan J. Burke, Massachusetts Department of Public Health; Sean O’Brien, Theresa Covell, Barnstable County Department of Health and the Environment; Marguerite M. Clougherty, John C. Welch, Community Tracing Collaborative; Jacob Lemieux, Christine Loreth, Stephen Schaffner, Chris Tomkins-Tinch, Lydia Krasilnikova, Pardis Sabeti, Broad Institute; Sari Sanchez, Boston Public Health Commission; Mark Anderson, Vance Brown, Ben Brumfield, Anna Llewellyn, Jessica Ricaldi, Julie Villanueva, CDC COVID-19 Response Team.

Corresponding author: Catherine Brown
SOURCE: https://www.cdc.gov/mmwr/volumes/70/wr/mm7031e2.htm

Moral of this story? Even if you have gotten the vaccine, ACT and TAKE PRECAUTIONS as if you haven't. IMHO.
 

Join now to reply to this thread or open new ones for your questions & comments! FaunaClassifieds.com is the largest online community about Reptile & Amphibians, Snakes, Lizards and number one classifieds service with thousands of ads to look for. Registration is open to everyone and FREE. Click Here to Register!

 
Reply

Thread Tools
Display Modes

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off

Similar Threads
Thread Thread Starter Forum Replies Last Post
[For Sale] Adult Zhou's Box,Chinese Golden Coin & Chinese Three Striped Turtles for sale alexcbreptiles Turtles/Tortoises 5 09-04-2014 04:00 AM
[For Sale] CHINESE GIANT TIGER LEGS AND CHINESE BEAUTIES! xenesthis13 Insects and Arachnids For Sale/Wanted Ads 0 08-14-2009 12:15 AM


All times are GMT -4. The time now is 01:17 AM.







Fauna Top Sites


Powered by vBulletin® Version 3.7.3
Copyright ©2000 - 2021, Jelsoft Enterprises Ltd.
Page generated in 0.14930892 seconds with 13 queries
Content copyrighted ©2002-2018, FaunaClassifieds, LLC